DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt3a

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001100475.2 Gene:Wnt3a / 303181 RGDID:1308057 Length:359 Species:Rattus norvegicus


Alignment Length:448 Identity:147/448 - (32%)
Similarity:205/448 - (45%) Gaps:125/448 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NLHLIVMIILACCTR-----------WLYGLPDG---------RATCRSVPGLTKDQVELCYKAS 94
            ||.::|:::....|:           .|:.|..|         ...|.|:|||...|:..|....
  Rat     3 NLCVVVVVVAEVLTQQLNDRALTSRVLLWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYV 67

  Fly    95 DVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA--SSLLKKGYRESAFAFAISAAGVA 157
            ::..:..||:...|:|||.||:..||||:::|    |..|  ..:|.|..|||||..||::||||
  Rat    68 EIMPSVAEGVKAGIQECQHQFRGRRWNCTTVS----NSLAIFGPVLDKATRESAFVHAIASAGVA 128

  Fly   158 HSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIA 222
            .:|.|:|::|....|||...:..                            :|.|          
  Rat   129 FAVTRSCAEGSAAICGCSSRLQG----------------------------SPGE---------- 155

  Fly   223 SRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSC 287
             .|||||||.:::||...|:.|.|.||...|.:|.:|.|||.|||.|::::|..:|||||:||||
  Rat   156 -GWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSC 219

  Fly   288 QLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLD 352
            ::||||.|.|||..:|..||.::..|          .|.||    .::::|.|.           
  Rat   220 EVKTCWWSQPDFRTIGDFLKDKYDSA----------SEMVV----EKHRESRGW----------- 259

  Fly   353 STDASGGHDDGGTGDSETRRHDELGVERGT--RQPSADKNAARMARKLETSLFYYQRSPNFCERD 415
                           .||.|      .|.|  :.|:            |..|.||:.||||||.:
  Rat   260 ---------------VETLR------PRYTYFKVPT------------ERDLVYYEASPNFCEPN 291

  Fly   416 LGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEEC 473
            ......||..|.||.::...|||..|||||||:...:||.|:|||.|.|||.|.|:||
  Rat   292 PETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQEC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 130/387 (34%)
Wnt3aNP_001100475.2 WNT1 51..359 CDD:128408 139/400 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.