DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt2

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_571025.1 Gene:wnt2 / 30127 ZFINID:ZDB-GENE-980526-416 Length:350 Species:Danio rerio


Alignment Length:422 Identity:131/422 - (31%)
Similarity:193/422 - (45%) Gaps:107/422 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WLYGLPDGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKS 129
            |..|....:..|.::|||...|.:||.:...|..|...|:...|.|||.||:.|||||::::.: 
Zfish    28 WYMGTLGSQVMCDNIPGLINKQRQLCRQHPKVMQAIGAGIKNWIGECQHQFRTHRWNCNTMARE- 91

  Fly   130 RNPH--ASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLD 192
               |  ...||.:..||:||.:|||:||:.:::.||||||.|.:|.|||  .:|..:::.:.:.|
Zfish    92 ---HNLFGRLLHRSSREAAFVYAISSAGMVYTLTRACSQGELENCSCDP--GKKGSSRDAKGAFD 151

  Fly   193 KEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCRE-KAGDIQS 256
                                              |||||.::|..::::::|:|.:| |..|.::
Zfish   152 ----------------------------------WGGCSDHVDHAIKFTQVFIDAKERKERDARA 182

  Fly   257 KINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNL 321
            .:|||||.|||.||...|...|||||:||||.::|||.:..||...|..|:.::..||.|..:..
Zfish   183 LMNLHNNRAGRKAVKRFMNLECKCHGVSGSCNVRTCWLAMADFRQTGDYLRKKYNNAIQVVMNQY 247

  Fly   322 GNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPS 386
                                 |:|.||                                      
Zfish   248 ---------------------GTGFTS-------------------------------------- 253

  Fly   387 ADKNAARM-ARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQV 450
                |.|| .|..:..|.|::.||::|..|..:...||.||.|||.:..:|.|..:|||||:...
Zfish   254 ----AYRMLKRPNKNDLVYFEDSPDYCIWDHESGSVGTGGRVCNRTSRGTDSCEVMCCGRGYDTS 314

  Fly   451 IQRRAERCHCKFQWCCNVECEECHVEEWISIC 482
            ...|..:|.|||||||.|.|.:|..|..:..|
Zfish   315 RVSRTTKCECKFQWCCAVHCRDCQEEVDVHTC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 119/387 (31%)
wnt2NP_571025.1 wnt 45..347 CDD:278536 126/405 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586762
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.