DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt8a

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio


Alignment Length:438 Identity:133/438 - (30%)
Similarity:185/438 - (42%) Gaps:139/438 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MIILACC-----TRWLYGLPDGRATCRSVPG--LTKDQVELCYKASDVTAAALEGLDMAIRECQI 113
            :::..||     |.|            ||..  :|..:..|.| .|.|.|.|..|    |.||:.
Zfish    10 LVMSICCHILSSTAW------------SVNNFLMTGPKAYLAY-TSSVQAGAQSG----IEECKH 57

  Fly   114 QFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTI 178
            ||.|.||||.. |....:.|..  |:...||:||..|||||||.:::.:.||.|...:||||.: 
Zfish    58 QFAWDRWNCPE-SALQLSTHKG--LRSATRETAFVHAISAAGVMYTLTKNCSMGDFENCGCDDS- 118

  Fly   179 NRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASR-WKWGGCSHNMDFGVEYSK 242
                                                  :..|:..| |.|||||.|::||...:|
Zfish   119 --------------------------------------KIGKMGGRGWVWGGCSDNVNFGDRIAK 145

  Fly   243 LFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVL- 306
            ||:|..|...|.::.:|||||.|||:||...::..|||||:||||.::|||....||..:|..| 
Zfish   146 LFVDALENGHDSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLK 210

  Fly   307 -KHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSET 370
             ||...:.:.:|:          :..||.|...|.|:                            
Zfish   211 IKHDQARKLEMDK----------IRMRAGNSADNRGA---------------------------- 237

  Fly   371 RRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKC-----NR 430
                           .||..:| :||   |.|.:.:.||::|.::|...:.||.||:|     |.
Zfish   238 ---------------IADTFSA-VAR---TELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNL 283

  Fly   431 NTTTSDGCTSLC--CGRGHSQVIQRRAE---RCHCKFQWCCNVECEEC 473
            :......|..||  ||   .:|.:||.|   .|:|||.|||.|:||.|
Zfish   284 SQWERRSCRRLCHECG---LKVEERRIETVSSCNCKFHWCCTVKCETC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 121/396 (31%)
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 131/426 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.