DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt8b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_006231504.1 Gene:Wnt8b / 293990 RGDID:1307644 Length:368 Species:Rattus norvegicus


Alignment Length:402 Identity:125/402 - (31%)
Similarity:170/402 - (42%) Gaps:117/402 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146
            :|..:..|.| :|.|.|.|..|    |.||:.||.|.||||...:.: .:.|..  |:...||:|
  Rat    47 MTGPKAYLVY-SSSVAAGAQSG----IEECKYQFAWDRWNCPERALQ-LSSHGG--LRSANRETA 103

  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211
            |..|||:|||.:::.|.||.|...:||||.:.|.:...:.                         
  Rat   104 FVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQG------------------------- 143

  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276
                         |.|||||.|:.||...||.|:|..|...|.::.:|||||.|||.||...|:.
  Rat   144 -------------WLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKR 195

  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341
            .|||||:||||..:|||...|:|..||..||.::..|:.||           :|:.|    .|..
  Rat   196 TCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVD-----------LLQGA----GNSA 245

  Fly   342 SGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQ 406
            :|.|:.:....|.                          .||:                 |.:.:
  Rat   246 AGRGAIADTFRSI--------------------------STRE-----------------LVHLE 267

  Fly   407 RSPNFCERDLGADIQGTVGRKCNRNTTT-----SDGCTSLC--CGRGHSQVIQRRAE---RCHCK 461
            .||::|..:....:.||.||:|.|....     ...|..||  ||..   |.:||||   .|:||
  Rat   268 DSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLA---VEERRAETVSSCNCK 329

  Fly   462 FQWCCNVECEEC 473
            |.|||.|.||:|
  Rat   330 FHWCCAVRCEQC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 119/393 (30%)
Wnt8bXP_006231504.1 WNT1 39..350 CDD:128408 125/402 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.