DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt8a

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001099625.1 Gene:Wnt8a / 291678 RGDID:1306312 Length:359 Species:Rattus norvegicus


Alignment Length:391 Identity:120/391 - (30%)
Similarity:171/391 - (43%) Gaps:117/391 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TAAALEGLDMAIRECQIQFQWHRWNCS----SLSTKSRNPHASSLLKKGYRESAFAFAISAAGVA 157
            ||:...|..|.:.||:.||.|.||||.    ..||.:| |..::      ||::|..||.:|.|.
  Rat    44 TASVALGAQMGMEECKFQFAWERWNCPEHAFQFSTHTR-PRGAT------RETSFIHAIRSAAVM 101

  Fly   158 HSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIA 222
            ::|.:.||.|.|.:||||.:.|.|.....                                    
  Rat   102 YAVTKNCSMGDLETCGCDESNNGKAGGHG------------------------------------ 130

  Fly   223 SRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSC 287
              |.|||||.|::||.:.|:||:|..||..|.::.:|||||.|||:||..:|:..|||||:||||
  Rat   131 --WIWGGCSDNVEFGEKISRLFVDSLEKGKDARALMNLHNNRAGRLAVRASMKRTCKCHGISGSC 193

  Fly   288 QLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLD 352
            .::|||....||..:|..||.::.:|:.::..              :.:...|....|..:|   
  Rat   194 SIQTCWLQLADFRQMGNYLKAKYDRALKIETD--------------KRQLRAGNRAEGRWAP--- 241

  Fly   353 STDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLG 417
                                     :|  ...|||           |..|.:.:.||::|.|:..
  Rat   242 -------------------------IE--AFLPSA-----------EAELIFLEGSPDYCNRNAS 268

  Fly   418 ADIQGTVGRKCNRNTTTSD-----GCTSLC--CGRGHSQVIQRRAE---RCHCKFQWCCNVECEE 472
            ..|.||.||:|.:|..::.     .|..||  ||   .||.:||.|   .|.|.|||||.|:|.:
  Rat   269 LGIYGTEGRECLQNARSASRWEQRSCGRLCTECG---LQVEERRTEAVSSCDCNFQWCCTVKCGQ 330

  Fly   473 C 473
            |
  Rat   331 C 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 115/382 (30%)
Wnt8aNP_001099625.1 WNT1 25..340 CDD:128408 120/391 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.