DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt6

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_033552.2 Gene:Wnt6 / 22420 MGIID:98960 Length:364 Species:Mus musculus


Alignment Length:453 Identity:144/453 - (31%)
Similarity:197/453 - (43%) Gaps:106/453 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PATSRHCNLHLIVMIILACCTR-----WLYGLP---DGRATCRSVPGLTKDQVELCYKASDVTAA 99
            |..||     |.::::|.|...     |..|.|   |..:.||....|...|.|||....:|.|.
Mouse     4 PVPSR-----LGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAE 63

  Fly   100 ALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASS---LLKKGYRESAFAFAISAAGVAHSVA 161
            ...|..:.:||||.||::.||||||        |:.:   :|::..||:||.|||:|||.:|:|.
Mouse    64 LARGARLGVRECQFQFRFRRWNCSS--------HSKAFGRVLQQDIRETAFVFAITAAGASHAVT 120

  Fly   162 RACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWK 226
            :|||.|.|:.|||.....|....                  .:..:.||...........::.|:
Mouse   121 QACSMGELLQCGCQAPRGRAPPR------------------PSGLLGTPGPPGPTGSPDASAAWE 167

  Fly   227 WGGCSHNMDFGVEYSKLFLDCREK--AGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQL 289
            ||||..::|||.|.|:||:|.:.|  .|||::.:.||||.|||:||.::....|||||:||||.|
Mouse   168 WGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCAL 232

  Fly   290 KTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDST 354
            :|||:..|.|..||..|..:|..|..|    :|..:...:|...|..|..|              
Mouse   233 RTCWQKLPPFREVGARLLERFHGASRV----MGTNDGKALLPAVRTLKPPG-------------- 279

  Fly   355 DASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGAD 419
                                                        ...|.|...||:||..:....
Mouse   280 --------------------------------------------RADLLYAADSPDFCAPNRRTG 300

  Fly   420 IQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISIC 482
            ..||.||.||.:.....||..|||||||.|...:..|.|.|:|.|||.|:|..|.|.:.:|:|
Mouse   301 SPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 124/388 (32%)
Wnt6NP_033552.2 Wnt_Wnt6 34..364 CDD:381712 135/418 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..162 2/39 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.