DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt5b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_036021918.1 Gene:Wnt5b / 22419 MGIID:98959 Length:394 Species:Mus musculus


Alignment Length:458 Identity:129/458 - (28%)
Similarity:191/458 - (41%) Gaps:135/458 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LIVMIILACCTRWLYGLPDGRA---------------------TCRSVPGLTKDQVELCYKASDV 96
            |:::::.|..:.|...|.|..:                     .|..:|||:..|.:||....:.
Mouse    39 LLLVVVAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRKLCQLYQEH 103

  Fly    97 TAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVA 161
            .:...||....|||||.||:..|||||::...|   ....:::.|.||:||.:|:|||||.::::
Mouse   104 MSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTS---VFGRVMQIGSRETAFTYAVSAAGVVNAIS 165

  Fly   162 RACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWK 226
            |||.:|.|.:|||......|.|.::                                      |.
Mouse   166 RACREGELSTCGCSRAARPKDLPRD--------------------------------------WL 192

  Fly   227 WGGCSHNMDFGVEYSKLFLDCRE------KAGDIQSK--INLHNNHAGRIAVSNNMEFRCKCHGM 283
            ||||..|:::|..::|.|:|.||      |..:.|.:  :||.||.|||.||....:..|||||:
Mouse   193 WGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGV 257

  Fly   284 SGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTS 348
            ||||.|||||....:|..||..||                                         
Mouse   258 SGSCSLKTCWLQLAEFRKVGDRLK----------------------------------------- 281

  Fly   349 PDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCE 413
                                  .::|.....|.|||...:...:|..:.....|.|...||::|.
Mouse   282 ----------------------EKYDSAAAMRITRQGKLELANSRFNQPTPEDLVYVDPSPDYCL 324

  Fly   414 RDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECH--VE 476
            |:......||.||.||:.:...|||..:|||||:.:....:.|||||:|.|||.|.|::|.  |:
Mouse   325 RNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVD 389

  Fly   477 EWI 479
            :::
Mouse   390 QYV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 115/391 (29%)
Wnt5bXP_036021918.1 Wnt_Wnt5b 83..394 CDD:381722 124/414 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.