DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt3a

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_033548.1 Gene:Wnt3a / 22416 MGIID:98956 Length:352 Species:Mus musculus


Alignment Length:402 Identity:140/402 - (34%)
Similarity:191/402 - (47%) Gaps:105/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA--SSLL 138
            |.|:|||...|:..|....::..:..||:...|:|||.||:..||||:::|    |..|  ..:|
Mouse    42 CASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVS----NSLAIFGPVL 102

  Fly   139 KKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLE 203
            .|..|||||..||::||||.:|.|:|::|....|||...:..                       
Mouse   103 DKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQG----------------------- 144

  Fly   204 TNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRI 268
                 :|.|           .|||||||.:::||...|:.|.|.||...|.:|.:|.|||.|||.
Mouse   145 -----SPGE-----------GWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQ 193

  Fly   269 AVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRA 333
            |::::|..:|||||:||||::||||.|.|||..:|..||.::..|          .|.||    .
Mouse   194 AIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSA----------SEMVV----E 244

  Fly   334 RNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGT--RQPSADKNAARMAR 396
            ::::|.|.                          .||.|      .|.|  :.|:          
Mouse   245 KHRESRGW--------------------------VETLR------PRYTYFKVPT---------- 267

  Fly   397 KLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCK 461
              |..|.||:.||||||.:......||..|.||.::...|||..|||||||:...:||.|:|||.
Mouse   268 --ERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCV 330

  Fly   462 FQWCCNVECEEC 473
            |.|||.|.|:||
Mouse   331 FHWCCYVSCQEC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 130/387 (34%)
Wnt3aNP_033548.1 Wnt_Wnt3_Wnt3a 39..352 CDD:381709 140/402 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.