DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt2

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_006505108.1 Gene:Wnt2 / 22413 MGIID:98954 Length:368 Species:Mus musculus


Alignment Length:421 Identity:136/421 - (32%)
Similarity:188/421 - (44%) Gaps:114/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WLYGLPD---------GRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRW 120
            |....||         .|..|.:||||...|.:||::..||..|...|:.....|||.||:.|||
Mouse    29 WFRLPPDRYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRW 93

  Fly   121 NCSSLSTKSRNPHA--SSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTL 183
            ||::|.    ..|:  ..:|.:..|||||.:|||:|||..::.||||||.|.||.|||  .:|..
Mouse    94 NCNTLD----RDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDP--KKKGS 152

  Fly   184 NKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCR 248
            .|:.:.:.|                                  |||||.|:|:|:::::.|:|.:
Mouse   153 AKDSKGTFD----------------------------------WGGCSDNIDYGIKFARAFVDAK 183

  Fly   249 EKAG-DIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRK 312
            |:.| |.::.:|||||.|||.||...::..|||||:||||.|:|||.:..||...|..|..::..
Mouse   184 ERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG 248

  Fly   313 AILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELG 377
            ||.|..:..|.|..|.      ||                                         
Mouse   249 AIQVVMNQDGTGFTVA------NK----------------------------------------- 266

  Fly   378 VERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLC 442
                           |..:..:..|.|::.||::|.||..|...||.||.||..:...|.|..:|
Mouse   267 ---------------RFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMC 316

  Fly   443 CGRGHSQVIQRRAERCHCKFQWCCNVECEEC 473
            ||||:......|..:|.|||.|||.|.|::|
Mouse   317 CGRGYDTSHVTRMTKCECKFHWCCAVRCQDC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 123/386 (32%)
Wnt2XP_006505108.1 Wnt_Wnt2 44..357 CDD:381719 133/406 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.