DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt1

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_067254.1 Gene:Wnt1 / 22408 MGIID:98953 Length:370 Species:Mus musculus


Alignment Length:394 Identity:132/394 - (33%)
Similarity:173/394 - (43%) Gaps:99/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA-SSLLKKGYRES 145
            |::.|..|..:...:..:...||..|:|||:.||:..||||.:    :..||. ..::.:|.||:
Mouse    64 LSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPT----APGPHLFGKIVNRGCRET 124

  Fly   146 AFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTP 210
            ||.|||::|||.|||||:||:|.:.||.||                                   
Mouse   125 AFIFAITSAGVTHSVARSCSEGSIESCTCD----------------------------------- 154

  Fly   211 EEEKKY-ERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNM 274
                 | .|......|.|||||.|:|||..:.:.|:|..||..|::..:|||||.|||..|.:.|
Mouse   155 -----YRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEM 214

  Fly   275 EFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSN 339
            ...||||||||||.::|||...|....||.||:.:|..|                   :|....|
Mouse   215 RQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGA-------------------SRVLYGN 260

  Fly   340 GGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFY 404
            .||...|.:..|........|                      :.||..            .|.|
Mouse   261 RGSNRASRAELLRLEPEDPAH----------------------KPPSPH------------DLVY 291

  Fly   405 YQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVE 469
            :::|||||.........||.||.||.::...|||..|||||||....||..|||:|.|.|||:|.
Mouse   292 FEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVS 356

  Fly   470 CEEC 473
            |..|
Mouse   357 CRNC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 127/385 (33%)
Wnt1NP_067254.1 WNT1 60..370 CDD:128408 132/394 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.