DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt9a

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_647459.1 Gene:Wnt9a / 216795 MGIID:2446084 Length:365 Species:Mus musculus


Alignment Length:405 Identity:125/405 - (30%)
Similarity:188/405 - (46%) Gaps:109/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146
            |.:.|..:|.:...|....:|.:.|:..|||.||::.|||| :|..:.|    :||||:|::|:|
Mouse    64 LERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNC-TLEGRYR----ASLLKRGFKETA 123

  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211
            |.:|||:||:.|::|:|||.||:..|.||             ::.|.|.::              
Mouse   124 FLYAISSAGLTHALAKACSAGRMERCTCD-------------EAPDLENRE-------------- 161

  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276
                        .|:||||..|:.:..::.|.||. |..:.|::::::.|||..|...:...:|.
Mouse   162 ------------AWQWGGCGDNLKYSSKFVKEFLG-RRSSKDLRARVDFHNNLVGVKVIKAGVET 213

  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILV-DQSNLGNGEPVVVLKRARNKKSNG 340
            .|||||:||||.::|||:....||.|||.|||::..::.| ..:|...||               
Mouse   214 TCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETSLKVGSTTNEATGE--------------- 263

  Fly   341 GSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYY 405
               :|:.||.......|||      ||...|..:                           |.:.
Mouse   264 ---AGAISPPRGRASGSGG------GDPLPRTPE---------------------------LVHL 292

  Fly   406 QRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGH---SQVIQRRAERCHCKFQWCCN 467
            ..||:||.  .|....||.||:|:|    ...|.|:||||||   |:|:.|   .|.|:.:|||.
Mouse   293 DDSPSFCL--AGRFSPGTAGRRCHR----EKNCESICCGRGHNTQSRVVTR---PCQCQVRWCCY 348

  Fly   468 VECEECHVEEWISIC 482
            |||.:|...|.:..|
Mouse   349 VECRQCTQREEVYTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 117/387 (30%)
Wnt9aNP_647459.1 Wnt 64..364 CDD:393294 125/405 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..287 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.