DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt11

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_536326.1 Gene:Wnt11 / 140584 RGDID:621463 Length:354 Species:Rattus norvegicus


Alignment Length:444 Identity:125/444 - (28%)
Similarity:180/444 - (40%) Gaps:121/444 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VMIILACCTRWLYGL--------PDGRAT-----CRSVPGLTKDQVELCYKASDVTAAALEGLDM 106
            ::..||..|...||:        |...|.     |:.:.||...||:||....::....:.....
  Rat    11 LLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCRSNLELMRTIVHAARE 75

  Fly   107 AIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMS 171
            |::.|:..|...||||||:...   |:....|::|.|||||.:|:|||.::|::||||:.|.|..
  Rat    76 AMKACRRAFADMRWNCSSIELA---PNYLLDLERGTRESAFVYALSAATISHTIARACTSGDLPG 137

  Fly   172 CGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDF 236
            |.|.|.........|                                       :||||:.|:.:
  Rat   138 CSCGPVPGEPPGPGN---------------------------------------RWGGCADNLSY 163

  Fly   237 GVEYSKLFLDCREKAGDIQSKIN----LHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAP 297
            |:.....|.|...|.....|:.|    |||:..||.|:..::|.:|||||:||||.::||||...
  Rat   164 GLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQ 228

  Fly   298 DFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDD 362
            :...|...||.::..|..|....:|..:.:|                   ..|||.....     
  Rat   229 ELRDVAADLKTRYLSATKVVHRPMGTRKHLV-------------------PKDLDIRPVK----- 269

  Fly   363 GGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRK 427
                |||                                |.|.|.||:||.::......||..|:
  Rat   270 ----DSE--------------------------------LVYLQSSPDFCMKNEKVGSHGTQDRQ 298

  Fly   428 CNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECH--VEEWI 479
            ||:.:..||.|..:|||||::....|..||||||:.|||.|.|..|.  ||.::
  Rat   299 CNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 109/387 (28%)
Wnt11NP_536326.1 Wnt_Wnt11 51..354 CDD:381717 116/404 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345745
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.