DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt2

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_575397.1 Gene:Wnt2 / 114487 RGDID:621346 Length:360 Species:Rattus norvegicus


Alignment Length:415 Identity:136/415 - (32%)
Similarity:188/415 - (45%) Gaps:108/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 WLYGLPDG---RATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLS 126
            |.|....|   |..|.:||||...|.:||::..||..|...|:.....|||.||:.|||||::|.
  Rat    27 WWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLD 91

  Fly   127 TKSRNPHA--SSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQ 189
                ..|:  ..:|.:..|||||.:|||:|||..::.||||||.|.||.|||  .:|...|:.:.
  Rat    92 ----RDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDP--KKKGSGKDSKG 150

  Fly   190 SLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAG-D 253
            :.|                                  |||||.|:|:|:::::.|:|.:|:.| |
  Rat   151 TFD----------------------------------WGGCSDNIDYGIKFARAFVDAKERKGKD 181

  Fly   254 IQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQ 318
            .::.:|||||.|||.||...::..|||||:||||.|:|||.:..||...|..|..::..||.|..
  Rat   182 ARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVM 246

  Fly   319 SNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTR 383
            :..|.|..|.      ||                                               
  Rat   247 NQDGTGFTVA------NK----------------------------------------------- 258

  Fly   384 QPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHS 448
                     |..:..:..|.|::.||::|.||..|...||.||.||..:...|.|..:|||||:.
  Rat   259 ---------RFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYD 314

  Fly   449 QVIQRRAERCHCKFQWCCNVECEEC 473
            .....|..:|.|||.|||.|.|::|
  Rat   315 TSHVTRMTKCECKFHWCCAVRCQDC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 123/386 (32%)
Wnt2XP_575397.1 wnt 47..349 CDD:278536 128/395 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.