DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and nek9

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_012823572.1 Gene:nek9 / 100216232 XenbaseID:XB-GENE-974101 Length:942 Species:Xenopus tropicalis


Alignment Length:328 Identity:71/328 - (21%)
Similarity:115/328 - (35%) Gaps:106/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 GRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCS 231
            |::::||.:.. |:..||:.....::.|..|.:.|  |..:...::...|:...|:.     |.:
 Frog   533 GKVLACGLNEH-NKLGLNQYTAGIINHEAFQEVPY--TTSLTLAKQLSFYKIRSISP-----GRT 589

  Fly   232 HN---------MDFGV---------EYSK-LFLD-----------CREKAGD---IQSKINLH-- 261
            |.         :.||.         :|.| |.::           .|...||   |.:..:.|  
 Frog   590 HTAAIDERGRLLTFGSNKCGQLGVGDYRKHLGINLLGGPLGGKQVIRVSCGDEFTIAATADNHIF 654

  Fly   262 ---NNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWK-------------SAPDFH---IVGKVLK 307
               |...||:|::.|       ....|| .:.|.|.             |...:|   ||.|||.
 Frog   655 AWGNGGNGRLAMTPN-------ERPQGS-DICTSWPRPIFGSLHHVTDLSCRGWHTILIVEKVLN 711

  Fly   308 HQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLD----STDASGGHDDGGTGDS 368
               .|.|..:.|.|..|          ....:..|||||...|.:    ::|.|.|.  .||.::
 Frog   712 ---SKTIRSNSSGLSIG----------TLAQSCSSGSGSREEDSERESLTSDPSRGF--RGTIEA 761

  Fly   369 ETRRHDELGVERGTRQPSADKNAARMARKLETSLFY-YQRSPNFCERDLGADIQGTVGRKCNRNT 432
            |    .|.|....|....:....:.:.::||.:.|. ...:|||            |..:.::|.
 Frog   762 E----PETGPFNTTENMESSSCPSWLRQELEEAEFIPMPDTPNF------------VSMESSQNG 810

  Fly   433 TTS 435
            |||
 Frog   811 TTS 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 71/328 (22%)
nek9XP_012823572.1 STKc_Nek9 33..290 CDD:270860
ATS1 370..708 CDD:227511 37/190 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.