DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt7bb

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_001920219.1 Gene:wnt7bb / 100148840 ZFINID:ZDB-GENE-081006-1 Length:352 Species:Danio rerio


Alignment Length:408 Identity:140/408 - (34%)
Similarity:194/408 - (47%) Gaps:99/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140
            |..:|||...|..:|....|......||..:.|.|||.||::.|||||:|..::   .....|:.
Zfish    42 CNKIPGLAPRQRAICQSRPDAIIVIGEGAQLGINECQYQFRYGRWNCSALGERT---VFGQELRV 103

  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETN 205
            |.||:||.:||:||||||:|..|||||.:..|||                 |:||:.:..     
Zfish   104 GSREAAFTYAITAAGVAHAVTAACSQGNMSHCGC-----------------DREKQGYYN----- 146

  Fly   206 QILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAV 270
                 :||          .|||||||.::.:|:|:|:.|:|.||...:.:..:|||||.|||..:
Zfish   147 -----QEE----------GWKWGGCSADIKYGIEFSRKFVDAREIKKNARRLMNLHNNEAGRKVL 196

  Fly   271 SNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARN 335
            ...|:..|||||:||||..||||.:.|.|..:|.|||.::.||:.|:           |::.:| 
Zfish   197 EERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKDKYNKAVQVE-----------VVRASR- 249

  Fly   336 KKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADK-NAARMARKLE 399
                                                          .|||:..| ...|..:.||
Zfish   250 ----------------------------------------------LRQPTFLKVKRTRHQKPLE 268

  Fly   400 TSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQW 464
            |.|.|.:||||:||.|......||.||.|||.:..:|||..:|||||::.....:..:|:|||||
Zfish   269 TDLVYIERSPNYCEEDAKTGSVGTQGRLCNRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFQW 333

  Fly   465 CCNVECEECHVEEWISIC 482
            ||.|:|..|.....:..|
Zfish   334 CCFVKCNTCSERTEVFTC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 131/384 (34%)
wnt7bbXP_001920219.1 wnt 48..352 CDD:278536 137/402 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.