DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt7b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:379 Identity:128/379 - (33%)
Similarity:180/379 - (47%) Gaps:100/379 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 MAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLM 170
            |.|.|||.||::.|||||:|..::   .....|:.|.||:||.:||:||||||:|..|||||.|.
 Frog     1 MGINECQYQFRYGRWNCSALGERT---VFGQELRVGSREAAFTYAITAAGVAHAVTSACSQGNLS 62

  Fly   171 SCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMD 235
            :|||                 |:||:.:..          :||          .|||||||.::.
 Frog    63 NCGC-----------------DREKQGYYN----------QEE----------GWKWGGCSADIK 90

  Fly   236 FGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFH 300
            :|:::|:.|:|.||...:.:..:|||||.|||..:...|:..|||||:||||..||||.:.|.|.
 Frog    91 YGIDFSRKFVDAREIKKNARRLMNLHNNEAGRKVLEEKMKLECKCHGVSGSCTTKTCWNTLPKFR 155

  Fly   301 IVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGT 365
            .:|.|||.::..|:.|:           |::..|                               
 Frog   156 EIGFVLKEKYNDAVHVE-----------VVRANR------------------------------- 178

  Fly   366 GDSETRRHDELGVERGTRQPS--ADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKC 428
                            .|||:  ..|......:.:||.|.|.:||||:||.|......||.||.|
 Frog   179 ----------------LRQPTFLKIKKVRSYQKPMETDLVYIERSPNYCEEDSATGSVGTQGRLC 227

  Fly   429 NRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISIC 482
            ||.:..:|||..:|||||::.....:..:|:|||.|||.|:|..|.....:..|
 Frog   228 NRTSPHTDGCDLMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 122/361 (34%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 128/379 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.