DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and pnpo

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001120016.1 Gene:pnpo / 100144978 XenbaseID:XB-GENE-955839 Length:228 Species:Xenopus tropicalis


Alignment Length:121 Identity:22/121 - (18%)
Similarity:34/121 - (28%) Gaps:63/121 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 CSSLSTKSRNPHASSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKN 186
            |.:.:|:...|.|..:|.||:....|.|                                ..|:.
 Frog    51 CLATATRDGRPSARMVLLKGFGPDGFRF--------------------------------YTNRE 83

  Fly   187 LRQSLDKEKKQFLQYLETNQI----------------------LTPEEEKKYERSK 220
            .|:.|:         ||||.:                      |:.||.:||..|:
 Frog    84 SRKGLE---------LETNPVASLLFYWEPFNRQVRIEGSIERLSEEESEKYFHSR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 22/121 (18%)
pnpoNP_001120016.1 pdxH 26..228 CDD:273138 22/121 (18%)
Pyridox_oxidase 44..122 CDD:279568 17/111 (15%)
PNPOx_C 175..228 CDD:287549
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.