DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt3

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001096552.1 Gene:wnt3 / 100125198 XenbaseID:XB-GENE-479567 Length:354 Species:Xenopus tropicalis


Alignment Length:403 Identity:134/403 - (33%)
Similarity:180/403 - (44%) Gaps:107/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHAS----- 135
            |.|:|||...|:..|....::..:..||:.:.|:|||.||:..||||:::       |.|     
 Frog    44 CGSIPGLVPKQMRFCRNYIEIMPSVAEGIKLGIQECQHQFRGRRWNCTTI-------HDSLAIFG 101

  Fly   136 SLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQ 200
            .:|.|..|||||..||::||||.:|.|:|::|....||||                         
 Frog   102 PVLDKATRESAFVHAIASAGVAFAVTRSCAEGSSTICGCD------------------------- 141

  Fly   201 YLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHA 265
                          .:.:......|||||||.:.||||..|:.|.|.||...|.:|.:|.|||.|
 Frog   142 --------------SHHKGSPGDGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNRHNNEA 192

  Fly   266 GRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVL 330
            ||..:.::|..||||||:||||::||||.|.|||..:|..||.::..|                 
 Frog   193 GRATILDHMHLRCKCHGLSGSCEVKTCWWSQPDFRAIGDHLKDKYDSA----------------- 240

  Fly   331 KRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMA 395
                                               .:....:|.|   .||..:....|.:. ..
 Frog   241 -----------------------------------SEMSVEKHRE---SRGWVETLRAKYSL-FK 266

  Fly   396 RKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHC 460
            ...|..|.||:.||||||.:......||.||.||..:...|||..|||||||:...::|.|:|||
 Frog   267 PPTERDLVYYETSPNFCEPNPETGSFGTQGRSCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHC 331

  Fly   461 KFQWCCNVECEEC 473
            .|.|||.|.|:||
 Frog   332 IFHWCCYVSCQEC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 124/388 (32%)
wnt3NP_001096552.1 Wnt_Wnt3_Wnt3a 41..354 CDD:381709 134/403 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.