DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt4b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_571575.1 Gene:wnt4b / 791993 ZFINID:ZDB-GENE-000411-1 Length:358 Species:Danio rerio


Alignment Length:387 Identity:122/387 - (31%)
Similarity:176/387 - (45%) Gaps:99/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMR---KILMRDSRETG 101
            |.||::.|..|..|.::.|           ||:.|||||||||:...:.:.   :::.:.:||..
Zfish    62 RARGEVMESVRKASEMVIE-----------ECQHQFRNRRWNCSTTPRGINVFGRVMNQGTREAA 115

  Fly   102 FVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQM 166
            ||:|:::|.|..|||:.|:.|:|..|.||:                                   
Zfish   116 FVHALSSAAVAVAVTRGCSRGELERCGCDR----------------------------------- 145

  Fly   167 PLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNV 231
                        ::...|                                 ||| ::|.|||||:
Zfish   146 ------------KVRGVS---------------------------------PEG-FQWSGCSDNL 164

  Fly   232 NFGLRHSRVFLDAKQRQRRSDLG-TLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKM 295
            ::|:..|:.|:|..:|.:....| .|:..|||.|||.||...|::||||||:||||.::|||..|
Zfish   165 SYGVAFSQTFVDEPERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVM 229

  Fly   296 PPFREVAGRLRDRYDSARKVTLRNDGN--SFMPESPHARPANKYQLVFADDSPDFCTPNSKTGAL 358
            ||||.|...|::.:|.|.:|.|...|:  :.:|..|..:|.....||:...|||||..:...|..
Zfish   230 PPFRRVGAVLKEHFDGATEVRLTRVGSRTALLPRDPQVKPPATRDLVYLAPSPDFCRLDPDNGIP 294

  Fly   359 GTQGRECNVTSS-GSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            ||.||.||.||. ..|.|:.|||..|......|....|.|.|.|||.|.|::|.....::||
Zfish   295 GTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCSCKFSWCCSVRCQQCKNTVLIHTC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 119/384 (31%)
wnt4bNP_571575.1 wnt 53..357 CDD:278536 122/387 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.