DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt11f2

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001138276.1 Gene:wnt11f2 / 791595 ZFINID:ZDB-GENE-990603-12 Length:353 Species:Danio rerio


Alignment Length:421 Identity:128/421 - (30%)
Similarity:188/421 - (44%) Gaps:98/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFGW----AEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIING 63
            ||:.|..|....|.||..|    ..|:::..:....||....|.....::|:.:..|:.. |:..
Zfish     8 LLLFITSLSVIYPCTGISWLGLTINGSSVGWNQTHHCKLLDGLVPDQQQLCKRNLELMHS-IVRA 71

  Fly    64 INLGFRECEFQFRNRRWNCTVLRKS--MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVE 126
            ..|....|...|.:.||||:.:..:  ....|.:.:||..||.::.||.|::|:.:||..|.|..
Zfish    72 ARLTKSACTSSFSDMRWNCSSIESAPHFTPDLAKGTREAAFVFSLAAAVVSHAIARACASGDLPS 136

  Fly   127 CSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAP 191
            |||                             |||           ||::            .||
Zfish   137 CSC-----------------------------AAM-----------PSEQ------------AAP 149

  Fly   192 VEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRS--DLG 254
                                         .:.||||.||:.:||:....|.||..|.|||  ...
Zfish   150 -----------------------------DFRWGGCGDNLRYGLQMGSAFSDAPIRNRRSGPQAF 185

  Fly   255 TLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRN 319
            .|::.|||..||..:.|::.::|||||:||||:|||||..:.....::..|:.:|.||.||..|.
Zfish   186 RLMQLHNNAVGRQVLMDSLEMKCKCHGVSGSCSVKTCWKGLQDISTISADLKSKYLSATKVIPRQ 250

  Fly   320 DG--NSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNR 382
            .|  ...:|.....||..:.:||:...|||:||.|:|.|:|||..|:||.|:|||:.|..:||.|
Zfish   251 IGTRRQLVPREMEVRPVGENELVYLVSSPDYCTQNAKQGSLGTTDRQCNKTASGSESCGLMCCGR 315

  Fly   383 G---HTRRIVEEQTNCKCVFKWCCEVTCEKC 410
            |   :|..:||   .|:|.:.|||.|:|:.|
Zfish   316 GYNAYTEVLVE---RCQCKYHWCCYVSCKTC 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 117/379 (31%)
wnt11f2NP_001138276.1 wnt 50..353 CDD:278536 117/379 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.