DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt10b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001072771.1 Gene:wnt10b / 780228 XenbaseID:XB-GENE-482664 Length:388 Species:Xenopus tropicalis


Alignment Length:404 Identity:135/404 - (33%)
Similarity:191/404 - (47%) Gaps:67/404 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLDPNLMCKKTRRLRGKLAEICRHD-----SALLKEIIINGINLGFRECEFQFRNRRWNCTVLRK 87
            :|.||.:|.....|..:...:|..:     |||      .||.:...||:.|.:.:||||:.| :
 Frog    39 ILTPNTVCLTLPGLSKRQMGLCVRNPDVTASAL------QGIQIAIHECQHQLKGQRWNCSTL-E 96

  Fly    88 SMRK------ILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTA 146
            :|.|      ||.|..||:.|..::.||||.::|..||::|:|..|.|:   .:|.|        
 Frog    97 TMGKMPHDSAILKRGFRESAFAFSLLAAGVMHSVATACSLGKLQGCGCE---WKRRG-------- 150

  Fly   147 ATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKF 211
                    .:::..:...|:.||.....:.|.|        |:.|:..   ....|.        
 Frog   151 --------TEEKIRLKLNQLQLQALSKVKGLPR--------DLTPLLR---ETPEPS-------- 188

  Fly   212 WDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLE 276
                  |:..||||||...:.||.:.||.|||:::..|  |:...::.|||..||.|:.:.|:..
 Frog   189 ------PQDTWEWGGCKHELEFGEKFSRDFLDSRESPR--DIHARMRIHNNRVGRQAVTENMKRR 245

  Fly   277 CKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRN-DGNSFMPESPHARPANKYQLV 340
            |||||.||||..||||...|.||.|...:||:...|..|..|| :..:|.|.....|.|.  :||
 Frog   246 CKCHGTSGSCQFKTCWHVTPDFRAVGTLMRDKLQRAVFVNSRNKNSGAFHPRLNKKRLAK--ELV 308

  Fly   341 FADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEV 405
            :.:.|||||..:.:..:.|||||.||.||...|.|..|||.|||...:...:..|.|.|.|||.|
 Frog   309 YFEKSPDFCEKDPRVDSPGTQGRVCNKTSQQMDNCASLCCGRGHNILMQTRRERCNCRFHWCCYV 373

  Fly   406 TCEKCLEHRAVNTC 419
            .||:|...:.||.|
 Frog   374 MCEECRVTQLVNVC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 130/389 (33%)
wnt10bNP_001072771.1 wnt 52..388 CDD:278536 131/391 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.