DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt9a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005163718.1 Gene:wnt9a / 751644 ZFINID:ZDB-GENE-060825-97 Length:363 Species:Danio rerio


Alignment Length:398 Identity:115/398 - (28%)
Similarity:177/398 - (44%) Gaps:106/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMRKILMRDSR 98
            :|.:. :|..|...:||.|.. :.|.::..|::...||::|||..|||||:..:....||.|..:
Zfish    58 LCDRL-KLEKKQRRMCRRDPG-VAETLMEAISMSALECQYQFRFERWNCTLEGRYRANILKRGFK 120

  Fly    99 ETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLR 163
            ||.|:.||::||:|:|:.|||:.|::..|:||:|        |.:                    
Zfish   121 ETAFLYAISSAGLTHAMAKACSAGRMERCTCDEA--------PDL-------------------- 157

  Fly   164 QQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCS 228
                                              .||:                   .|:||||.
Zfish   158 ----------------------------------ENRK-------------------AWQWGGCG 169

  Fly   229 DNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWL 293
            ||:.:..:..:.||.   ::...||...:..||:|.|...|:..:...|||||:||||||:|||.
Zfish   170 DNLKYSNKFVKDFLG---KRSNKDLRARIDMHNSNVGMKVIKTGVETTCKCHGVSGSCTVQTCWR 231

  Fly   294 KMPPFREVAGRLRDRYDSARKVT-----LRNDGNSFMPESPHARP-----ANKYQLVFADDSPDF 348
            ::.||.|:..:|:.||:::.||.     ...:|......|...:|     .....|:..:|||.|
Zfish   232 QLAPFHEIGKQLKQRYETSVKVASSTNEATGEGEISQSRSQSQQPPQPDIPRTPDLLHIEDSPSF 296

  Fly   349 CTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHT--RRIVEEQTNCKCVFKWCCEVTCEKCL 411
            |.| ||..| ||..|:|....:    |:.:||.|||.  .|:|...  |:|..:|||.|.|::|.
Zfish   297 CRP-SKYSA-GTLARKCYKDKN----CEAICCGRGHNTQSRVVTRP--CQCQVRWCCYVECKQCT 353

  Fly   412 EHRAVNTC 419
            :...|.||
Zfish   354 QKEEVYTC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 112/389 (29%)
wnt9aXP_005163718.1 wnt 64..362 CDD:278536 114/391 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.