DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT9B

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens


Alignment Length:418 Identity:118/418 - (28%)
Similarity:184/418 - (44%) Gaps:110/418 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PMTGFGW----AEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQF 75
            |..|.|.    |:|...|...:|: |.:||.:    ::||.:.. |.|.:.:..:||..||:|||
Human    41 PFPGLGTAAAPAQGGAHLKQCDLL-KLSRRQK----QLCRREPG-LAETLRDAAHLGLLECQFQF 99

  Fly    76 RNRRWNCTVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQ 140
            |:.||||::  :....:|.|..:||.|:.|:::|.:|:.:.:||:.|::..|:||.:        
Human   100 RHERWNCSL--EGRMGLLKRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDS-------- 154

  Fly   141 PQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGR 205
                      ..||.:|                                                
Human   155 ----------PGLESRQ------------------------------------------------ 161

  Fly   206 RGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIR 270
                           .|:||.|.||:.:..:....||.:|:..:  ||......||.:.|..|::
Human   162 ---------------AWQWGVCGDNLKYSTKFLSNFLGSKRGNK--DLRARADAHNTHVGIKAVK 209

  Fly   271 DAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV-TLRNDGNSFMPESPHARPA 334
            ..:|..|||||:||||.|:|||.::.||||....|:.|||||.|| :..|:....:.....||..
Human   210 SGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQG 274

  Fly   335 N--------KYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEE 391
            :        ...||:.:|||.||.|:..:.  ||.||.|:..:|    |..|||.||:..:....
Human   275 SLTKGLAPRSGDLVYMEDSPSFCRPSKYSP--GTAGRVCSREAS----CSSLCCGRGYDTQSRLV 333

  Fly   392 QTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            ..:|.|..:|||.|.|::|::...|.||
Human   334 AFSCHCQVQWCCYVECQQCVQEELVYTC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 106/386 (27%)
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 110/392 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.