DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT10B

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens


Alignment Length:407 Identity:136/407 - (33%)
Similarity:194/407 - (47%) Gaps:76/407 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LDPNLMCKKTRRLRGKLAEICRHD-----SALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKS 88
            |..|.:|.....|..:...:|..:     |||      .|:::...||:.|.|::||||:.|...
Human    42 LTANTVCLTLSGLSKRQLGLCLRNPDVTASAL------QGLHIAVHECQHQLRDQRWNCSALEGG 100

  Fly    89 MR-----KILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAAT 148
            .|     .||.|..||:.|..::.||||.:||..||::|:||.|.|.   .:.:|.|.::     
Human   101 GRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCG---WKGSGEQDRL----- 157

  Fly   149 AEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNN-ASTMTDIAPVEHRGGRNRRPGGRRGRRKFW 212
                     :|.:|:          .|.|||..: ..::....|     |.:..||         
Human   158 ---------RAKLLQ----------LQALSRGKSFPHSLPSPGP-----GSSPSPG--------- 189

  Fly   213 DNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLEC 277
                 |:..||||||:.:::||.:.||.|||:::..|  |:...::.|||..||..:.:.::.:|
Human   190 -----PQDTWEWGGCNHDMDFGEKFSRDFLDSREAPR--DIQARMRIHNNRVGRQVVTENLKRKC 247

  Fly   278 KCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRN-DGNSFMPESPHARPAN-KYQLV 340
            ||||.||||..||||...|.||.|...||:|...|..:...| :..:|   .|..||.. ..:||
Human   248 KCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAF---QPRLRPRRLSGELV 309

  Fly   341 FADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQT---NCKCVFKWC 402
            :.:.|||||..:...|:.||:||.||.||...|.|..|||.|||.   |..||   .|.|.|.||
Human   310 YFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHN---VLRQTRVERCHCRFHWC 371

  Fly   403 CEVTCEKCLEHRAVNTC 419
            |.|.|::|.....||.|
Human   372 CYVLCDECKVTEWVNVC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 132/393 (34%)
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 135/404 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.