DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT8A

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens


Alignment Length:365 Identity:123/365 - (33%)
Similarity:170/365 - (46%) Gaps:100/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GINLGFRECEFQFRNRRWNC--TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLV 125
            |...|..||:|||...||||  ..|:.|....|...:|||.|::||::|||.|.:||.|:||...
Human    86 GAQSGIEECKFQFAWERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFE 150

  Fly   126 ECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIA 190
            .|.||                                                            
Human   151 NCGCD------------------------------------------------------------ 155

  Fly   191 PVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT 255
                 |..|.:.||.               .|.||||||||.||.|.|::|:|:.::.:  |...
Human   156 -----GSNNGKTGGH---------------GWIWGGCSDNVEFGERISKLFVDSLEKGK--DARA 198

  Fly   256 LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL--- 317
            |:..|||.|||||:|..|:..|||||:||||:::||||::..|||:...|:.:||.|.|:.:   
Human   199 LMNLHNNRAGRLAVRATMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMDKR 263

  Fly   318 -RNDGNS----FMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDR--- 374
             ...|||    ::|..... |:.:.:|:|.::|||:||.||..|..||:||||...|..:.|   
Human   264 QLRAGNSAEGHWVPAEAFL-PSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWER 327

  Fly   375 --CDRLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410
              |.|||  |......|..|..::|.|.|:|||.|.|::|
Human   328 RSCGRLCTECGLQVEERKTEVISSCNCKFQWCCTVKCDQC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 123/365 (34%)
WNT8AXP_016865313.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.