DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT7B

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011528668.1 Gene:WNT7B / 7477 HGNCID:12787 Length:353 Species:Homo sapiens


Alignment Length:427 Identity:142/427 - (33%)
Similarity:197/427 - (46%) Gaps:94/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGIN 65
            |:.|....||.:..:|...|..:.:.|..|::|.|...|..:...||  |.|:.:   :|..|..
Human    10 LVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII---VIGEGAQ 71

  Fly    66 LGFRECEFQFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECS 128
            :|..||::|||..||||:.|  :....:.|...|||..|..|||||||.:|||.||:.|.|..|.
Human    72 MGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCG 136

  Fly   129 CDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVE 193
            ||:                                                             |
Human   137 CDR-------------------------------------------------------------E 140

  Fly   194 HRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVK 258
            .:|..|:..|                  |:|||||.:|.:|:..||.|:||  |:.:.:...|:.
Human   141 KQGYYNQAEG------------------WKWGGCSADVRYGIDFSRRFVDA--REIKKNARRLMN 185

  Fly   259 FHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS 323
            .|||.|||..:.|.|:|||||||:|||||.||||..:|.||||...|:::|::|.:|.:......
Human   186 LHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRL 250

  Fly   324 FMPESPHARPANKYQ------LVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNR 382
            ..|.....:....||      ||:.:.||::|..::.||::|||||.||.||.|:|.||.:||.|
Human   251 RQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGR 315

  Fly   383 GHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            |:......:...|.|.|.|||.|.|..|.|...|.||
Human   316 GYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 130/387 (34%)
WNT7BXP_011528668.1 wnt_Wnt7b 36..353 CDD:381724 136/401 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.