DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT7A

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_004616.2 Gene:WNT7A / 7476 HGNCID:12786 Length:349 Species:Homo sapiens


Alignment Length:404 Identity:138/404 - (34%)
Similarity:192/404 - (47%) Gaps:96/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVL--RK 87
            :.|..:::|.|...|..:...||  |.|:.:   :|..|..:|..||:|||||.||||:.|  |.
Human    30 VALGASIICNKIPGLAPRQRAICQSRPDAII---VIGEGSQMGLDECQFQFRNGRWNCSALGERT 91

  Fly    88 SMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAA 152
            ...|.|...|||..|..||.||||.:|:|.|||.|.|.:|.|||                     
Human    92 VFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDK--------------------- 135

  Fly   153 LERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKF 217
             |:|.|                                  .||                      
Human   136 -EKQGQ----------------------------------YHR---------------------- 143

  Fly   218 PEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGL 282
            .|| |:|||||.::.:|:..::||:||  |:.:.:..||:..|||.|||..:.:.|:|||||||:
Human   144 DEG-WKWGGCSADIRYGIGFAKVFVDA--REIKQNARTLMNLHNNEAGRKILEENMKLECKCHGV 205

  Fly   283 SGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV----TLRNDGNSFMP-ESP--HARPANKYQLV 340
            |||||.||||..:|.|||:...|:|:|:.|..|    ..||...:|:. :.|  :.:|.:. .||
Human   206 SGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDT-DLV 269

  Fly   341 FADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEV 405
            :.:.||::|..:..||::|||||.||.|:..:..||.:||.||:..........|.|.|.|||.|
Human   270 YIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYV 334

  Fly   406 TCEKCLEHRAVNTC 419
            .|..|.|...:.||
Human   335 KCNTCSERTEMYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 133/388 (34%)
WNT7ANP_004616.2 Wnt_Wnt7a 32..349 CDD:381723 138/402 (34%)
Disordered linker. /evidence=ECO:0000269|PubMed:30026314 238..266 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.