DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT3

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_110380.1 Gene:WNT3 / 7473 HGNCID:12782 Length:355 Species:Homo sapiens


Alignment Length:404 Identity:139/404 - (34%)
Similarity:191/404 - (47%) Gaps:109/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMR---KILM 94
            |:|.....|..|....||:...::.. :..|:.||.:||:.|||.||||||.:..|:.   .:|.
Human    43 LLCGSIPGLVPKQLRFCRNYIEIMPS-VAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLD 106

  Fly    95 RDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQA 159
            :.:||:.||:||.:|||.:|||::|..|....|.||..|                          
Human   107 KATRESAFVHAIASAGVAFAVTRSCAEGTSTICGCDSHH-------------------------- 145

  Fly   160 AMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQ-WE 223
                                                                    |.|.|: |:
Human   146 --------------------------------------------------------KGPPGEGWK 154

  Fly   224 WGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTV 288
            |||||::.:||:..||.|.||  |:.|.|..:.:..|||.|||..|.|.|.|:||||||||||.|
Human   155 WGGCSEDADFGVLVSREFADA--RENRPDARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEV 217

  Fly   289 KTCWLKMPPFREVAGRLRDRYDSARKV-------------TLRNDGNSFMPESPHARPANKYQLV 340
            ||||...|.||.:...|:|:||||.::             |||...:.|       :|..:..||
Human   218 KTCWWAQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRAKYSLF-------KPPTERDLV 275

  Fly   341 FADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEV 405
            :.::||:||.||.:||:.||:.|.|||||.|.|.||.|||.|||..|..:.:..|.|:|.|||.|
Human   276 YYENSPNFCEPNPETGSFGTRDRTCNVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYV 340

  Fly   406 TCEKCLEHRAVNTC 419
            :|::|:....|:||
Human   341 SCQECIRIYDVHTC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 135/394 (34%)
WNT3NP_110380.1 Wnt_Wnt3_Wnt3a 42..355 CDD:381709 139/404 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.