DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT1

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_005421.1 Gene:WNT1 / 7471 HGNCID:12774 Length:370 Species:Homo sapiens


Alignment Length:450 Identity:153/450 - (34%)
Similarity:210/450 - (46%) Gaps:126/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFG--W-----AEGTNIL---------LDPN--LMCKKTRRLRGKLAEIC 49
            ||:.:|.|..|:.....|  |     |..||:|         |:|:  |:.:|.|||       .
Human    15 LLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRL-------I 72

  Fly    50 RHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVT 112
            |.:..:|.. :..|:....|||::|||||||||...  .....||:.|..|||.|:.|||:||||
Human    73 RQNPGILHS-VSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVT 136

  Fly   113 YAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRL 177
            ::|.::|:.|.:..|:||.                                              
Human   137 HSVARSCSEGSIESCTCDY---------------------------------------------- 155

  Fly   178 SRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFL 242
                                |.|.|||             |:  |.|||||||::||....|.|:
Human   156 --------------------RRRGPGG-------------PD--WHWGGCSDNIDFGRLFGREFV 185

  Fly   243 DAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRD 307
            |:.::.|  ||..|:..|||.|||..:...||.||||||:||||||:|||:::|..|.|...|||
Human   186 DSGEKGR--DLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRD 248

  Fly   308 RYDSARKVTLRNDGNS---------FMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGR 363
            |:|.|.:|...|.|::         ..||.|..:|.:.:.||:.:.||:|||.:.:.|..||.||
Human   249 RFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGR 313

  Fly   364 ECNVTSSGSDRCDRLCCNRGH---TRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTCL 420
            .||.:|...|.|:.|||.|||   |:|:.|   .|.|.|.|||.|:|..|...|.::.||
Human   314 ACNSSSPALDGCELLCCGRGHRTRTQRVTE---RCNCTFHWCCHVSCRNCTHTRVLHECL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 134/391 (34%)
WNT1NP_005421.1 Wnt_Wnt1 64..370 CDD:381707 137/399 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.