DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt7aa

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001020711.1 Gene:wnt7aa / 565714 ZFINID:ZDB-GENE-051129-1 Length:349 Species:Danio rerio


Alignment Length:419 Identity:139/419 - (33%)
Similarity:193/419 - (46%) Gaps:98/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGINLGFRECEF 73
            |..:.:.||    .:.:.|..:::|.|...|..:...||  |.|:.:   :|..|..:|..||:|
Zfish    18 IIYLKIGGF----SSVVALGASIICNKIPGLAPRQRTICQSRPDAII---VIGEGAQMGINECQF 75

  Fly    74 QFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRR 136
            ||:|.||||:.|  |....|.|...|:|..|..||.||||.:|:|.|||.|.|..|.|||     
Zfish    76 QFKNGRWNCSALGERTVFGKELKVGSKEAAFTYAIIAAGVAHAITAACTQGTLSGCGCDK----- 135

  Fly   137 NGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRR 201
                                                                    |.:|..|:.
Zfish   136 --------------------------------------------------------EKQGFYNQE 144

  Fly   202 PGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGR 266
            .|                  |:|||||.::.:||..|:|||||  |:.:.:..||:..|||..||
Zfish   145 EG------------------WKWGGCSADIRYGLSFSKVFLDA--REIKQNARTLMNLHNNEVGR 189

  Fly   267 LAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV----TLRNDGNSFMP- 326
            ..:...|||||||||:|||||.||||..:|.||::...|::||:.|..|    ..||...:|:. 
Zfish   190 KILEKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKERYNHAVHVEPVRASRNKRPAFLKV 254

  Fly   327 ESPHA-RPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVE 390
            :.|:: |......||:.:.||::|..:..||::|||||.||.|:..::.||.:||.||:......
Zfish   255 KKPYSYRKPMDTDLVYIEKSPNYCEADPVTGSMGTQGRICNKTAQHTNGCDLMCCGRGYNTHQYS 319

  Fly   391 EQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            ....|.|.|.|||.|.|..|.|...|.||
Zfish   320 RVWQCNCKFLWCCYVKCNTCSERTEVYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 131/387 (34%)
wnt7aaNP_001020711.1 wnt 44..349 CDD:278536 133/389 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26044
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.