DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt9b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001131132.1 Gene:wnt9b / 565677 ZFINID:ZDB-GENE-080201-1 Length:358 Species:Danio rerio


Alignment Length:445 Identity:120/445 - (26%)
Similarity:185/445 - (41%) Gaps:127/445 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLLMVIAILIFAMPMTGFGWAEGTNILLDPNL-----------MCKK---TRRLRGKLAEICRH 51
            :||:.:..:|..|....|....|....|..|..           .|::   |||.:    .:||.
Zfish    12 LRLIALCILLSHAAAYFGLTGREPLVFLPGPFANEPTNGKAHLKQCEQMTLTRRQK----RLCRR 72

  Fly    52 DSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMRKILMRDSRETGFVNAITAAGVTYAVT 116
            :.. |.|.:...:.|...||.:||||.||||::  .....:|.|..:||.|:.|:::|.:::|:.
Zfish    73 EPG-LAETLRESVRLSLLECRYQFRNERWNCSM--DGRGSLLKRGFKETAFLLAVSSAALSHALA 134

  Fly   117 KACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMN 181
            |||:.|::..|:||                                                   
Zfish   135 KACSSGRMERCTCD--------------------------------------------------- 148

  Fly   182 NASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQ 246
                  |...::||..                        |:||.|.||:.:..:..:.||.  |
Zfish   149 ------DSPGLQHREA------------------------WQWGVCGDNLKYSTKFLKKFLG--Q 181

  Fly   247 RQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDS 311
            ::...||...:..||.|.|..|::..::..|||||:||||.|:|||.::.||::....|:.|||:
Zfish   182 KRVSKDLRAQIDAHNINVGIRAVKSGLKTTCKCHGVSGSCAVRTCWKQLSPFQDTGHLLKYRYDT 246

  Fly   312 ARKVTLRNDGNSFMPES------------PHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRE 364
            |  |.:.:..||...|:            |..||.   :|||.::||.||.|:..:.  ||.||.
Zfish   247 A--VRVHSVTNSATGETELAGPRRHSITLPRPRPT---ELVFLEESPSFCRPSRYSP--GTAGRP 304

  Fly   365 CNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            |:..:|    |..|||.||:...:.....:|.|..:|||.|.|:.||....|.||
Zfish   305 CSKDTS----CSSLCCGRGYNTALRLTTLSCHCQVRWCCHVECQTCLREEEVYTC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 106/389 (27%)
wnt9bNP_001131132.1 Wnt_Wnt9b 62..356 CDD:381728 111/395 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.