DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt7ba

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_691878.2 Gene:wnt7ba / 563427 ZFINID:ZDB-GENE-041210-178 Length:353 Species:Danio rerio


Alignment Length:427 Identity:143/427 - (33%)
Similarity:193/427 - (45%) Gaps:94/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFGWAEGTNILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGIN 65
            ||.|....||.:..:|...|..:.:.|..|::|.|...|..:...||  |.|:.:   ||..|..
Zfish    10 LLSVYYPQIFLILTSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRPDAII---IIGEGAQ 71

  Fly    66 LGFRECEFQFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECS 128
            ||..||::|||..||||:.|  |....:.|...|:|..|..|||||||.:|||.||:.|.|..|.
Zfish    72 LGINECQYQFRYGRWNCSALGERTVFGQELRVGSKEAAFTYAITAAGVAHAVTAACSQGNLSHCG 136

  Fly   129 CDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVE 193
            ||                                |::....||.                     
Zfish   137 CD--------------------------------REKQGYHDQE--------------------- 148

  Fly   194 HRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVK 258
                                     || |:|||||.:|.:|:..||.|:||  |:.:.:...|:.
Zfish   149 -------------------------EG-WKWGGCSADVKYGVEFSRRFVDA--REIKKNARRLMN 185

  Fly   259 FHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS 323
            .|||.|||..:.:.|:|||||||:|||||.||||..:|.|||:...|::||.:|.:|........
Zfish   186 LHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREIGYVLKERYTTALEVEAVRATRF 250

  Fly   324 FMPESPHARPANKY------QLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNR 382
            ..|.....:.:..|      .|||.:.||::|..::.||:.||:||.||.||..:|.|:.:||.|
Zfish   251 RQPSFLRLKQSRGYIKPTDTDLVFLERSPNYCEEDTVTGSAGTRGRLCNHTSPLTDGCNLMCCGR 315

  Fly   383 GHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            ||..........|.|.|:|||.|.|..|.|...|.||
Zfish   316 GHNTHQYTRVWQCNCKFQWCCFVKCNTCSEKTEVFTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 130/387 (34%)
wnt7baXP_691878.2 wnt 48..353 CDD:278536 132/389 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26044
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.