DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT4

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011539899.1 Gene:WNT4 / 54361 HGNCID:12783 Length:373 Species:Homo sapiens


Alignment Length:391 Identity:132/391 - (33%)
Similarity:197/391 - (50%) Gaps:89/391 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 CKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRK--SMRKILMRDS 97
            |:|.:.|..:..::|:.:..:: :.:..|..|...||::|||||||||:.|..  ...|::.:.:
Human    65 CEKLKGLIQRQVQMCKRNLEVM-DSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGT 128

  Fly    98 RETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAML 162
            ||..||.||::|||.:|||:||:.|:|.:|.||:                               
Human   129 REAAFVYAISSAGVAFAVTRACSSGELEKCGCDR------------------------------- 162

  Fly   163 RQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGC 227
                                  |:..::                           |:| ::|.||
Human   163 ----------------------TVHGVS---------------------------PQG-FQWSGC 177

  Fly   228 SDNVNFGLRHSRVFLDAKQRQR-RSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTC 291
            |||:.:|:..|:.|:|.::|.: .|....|:..|||.|||.||...||:||||||:||||.||||
Human   178 SDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTC 242

  Fly   292 WLKMPPFREVAGRLRDRYDSARKVTLRNDGNS--FMPESPHARPANKYQLVFADDSPDFCTPNSK 354
            |..:||||:|...|::::|.|.:|..|..|:|  .:|.:...:|.....||:.:.|||||..:.:
Human   243 WRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMR 307

  Fly   355 TGALGTQGRECNVTSSGSDRCDRLCCNRG-HTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNT 418
            :|.|||:||.||.||...|.|:.|||.|| ||.: ||....|.|.|.|||.|.|.:|.....::|
Human   308 SGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQ-VELAERCSCKFHWCCFVKCRQCQRLVELHT 371

  Fly   419 C 419
            |
Human   372 C 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 128/383 (33%)
WNT4XP_011539899.1 wnt 71..373 CDD:278536 130/385 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.