DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and WNT16

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_476509.1 Gene:WNT16 / 51384 HGNCID:16267 Length:365 Species:Homo sapiens


Alignment Length:435 Identity:131/435 - (30%)
Similarity:193/435 - (44%) Gaps:98/435 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLLMVIAILIFAMPMTGFG---WAEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIING 63
            ||..:.|.|:...|....|   |....:..:...|.|... .|..:..|:|:....||.. |..|
Human    11 RLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANL-PLNSRQKELCKRKPYLLPS-IREG 73

  Fly    64 INLGFRECEFQFRNRRWNCTVLRKSMRK----------ILMRDSRETGFVNAITAAGVTYAVTKA 118
            ..||.:||..|||:.||||.:...:...          .|...::||.|:.|:.|||:.::||::
Human    74 ARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTRS 138

  Fly   119 CTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNA 183
            |:.|.:.|||||..  .:|||                                          :|
Human   139 CSAGNMTECSCDTT--LQNGG------------------------------------------SA 159

  Fly   184 STMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLD---AK 245
            |                                  || |.||||||:|.:|:..||.|||   ..
Human   160 S----------------------------------EG-WHWGGCSDDVQYGMWFSRKFLDFPIGN 189

  Fly   246 QRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYD 310
            ...:.:.:...:..|||.|||.|:...|.::|:|||:||||.|||||..|..|.::...|:|:|:
Human   190 TTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYE 254

  Fly   311 SARKVTLRNDGNSFMPESPHAR-PANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDR 374
            ::.:::.:........|....: |.:|..|::.:.||::|..:.|.|..||||||||.||.|:|.
Human   255 NSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG 319

  Fly   375 CDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            |:.|||.||:...:|.....|:|.|.|||.|.|.:|.....|:||
Human   320 CNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 120/391 (31%)
WNT16NP_476509.1 wnt 52..365 CDD:306592 122/393 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.