DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wntD

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:375 Identity:74/375 - (19%)
Similarity:129/375 - (34%) Gaps:115/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KEIIINGINLGFRECEFQFRNRRWNC---TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKA 118
            ::|...|:......|:..|:.:||||   ..::|:.:......:||..:|.||:.|.:.:.:||.
  Fly    37 EDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKD 101

  Fly   119 CTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNA 183
            |..|.:..|.|                   .|.||           .:|...: |::.|.:..  
  Fly   102 CANGVIAGCGC-------------------TENAL-----------NVPCAHE-PTKALEQYE-- 133

  Fly   184 STMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQ 248
                     :|.|..:...|                                             
  Fly   134 ---------KHFGSGSGAIG--------------------------------------------- 144

  Fly   249 RRSDLGTLVKFHNNNAGRLAIRDAMRLECKCH---GLSGSCTVKTCWLKMPPFREVAGRLRDRYD 310
                       ||.......::.::..||:|.   .:.|.|..:.|...:.||..:|..|...||
  Fly   145 -----------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYD 198

  Fly   311 SARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGS--D 373
            .|.::...:.....|.::   .|.:  .|||..|||::|..::.....||:||:|:...|||  :
  Fly   199 DAIQLEGASSNLKIMWQN---IPLD--SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEE 258

  Fly   374 R--CDRLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            |  |.:||  |......:.|..:..|.|...|...:.|:.|::.....:|
  Fly   259 RLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 73/373 (20%)
wntDNP_650272.1 wnt 41..308 CDD:302926 72/369 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.