DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt10a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001101697.1 Gene:Wnt10a / 316527 RGDID:1307015 Length:417 Species:Rattus norvegicus


Alignment Length:442 Identity:149/442 - (33%)
Similarity:204/442 - (46%) Gaps:75/442 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFGWAEGTNI----LLDPNLMCKKTRRLRGKLAEIC-RHDSALLKEIIIN 62
            ||..:.:|..|:|.:......|..:    :|:.|.:|.....|..:..|:| ||......  .|.
  Rat    25 LLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTVCLTLPGLSRRQMEVCVRHPDVAAS--AIQ 87

  Fly    63 GINLGFRECEFQFRNRRWNCTVLRKSMR-----KILMRDSRETGFVNAITAAGVTYAVTKACTMG 122
            ||.:...||:.|||::||||:.|....:     .|..|..||:.|..||.||||.:||:.||.:|
  Rat    88 GIQIAIHECQHQFRDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACALG 152

  Fly   123 QLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMT 187
            :|..|.||.:  ||  |..:..........|:..|:...|...:|   :||:             
  Rat   153 KLKACGCDAS--RR--GDEEAFRRKLHRLQLDALQRGKGLSHGVP---EHPA------------- 197

  Fly   188 DIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSD 252
             |.|..        ||              .:..|||||||.:|.||.|.|:.|||:::..|  |
  Rat   198 -IPPAS--------PG--------------LQDSWEWGGCSPDVGFGERFSKDFLDSREPHR--D 237

  Fly   253 LGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL 317
            :...::.|||..||.|:.:.||.:|||||.||||.:||||...|.||.|...||:|:   .:.||
  Rat   238 IHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRNRF---HRATL 299

  Fly   318 -----RNDGN---------SFMPESPH-ARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNV 367
                 ||.|.         |..|.:|. .|.|:...||:.:.|||||....:..:.||.||.||.
  Rat   300 IRPHNRNGGQLEPGLAGAPSPAPGTPGLRRRASHSDLVYFEKSPDFCEREPRLDSAGTVGRLCNK 364

  Fly   368 TSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            :|:|.|.|..:||.|||..........|.|.|.|||.|.||:|.....|:.|
  Rat   365 SSTGPDSCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 139/398 (35%)
Wnt10aNP_001101697.1 wnt 67..417 CDD:278536 140/400 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.