DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt3a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001100475.2 Gene:Wnt3a / 303181 RGDID:1308057 Length:359 Species:Rattus norvegicus


Alignment Length:396 Identity:135/396 - (34%)
Similarity:186/396 - (46%) Gaps:93/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKSMR---KILM 94
            ::|.....|..|....||:...::.. :..|:..|.:||:.|||.||||||.:..|:.   .:|.
  Rat    47 ILCASIPGLVPKQLRFCRNYVEIMPS-VAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLD 110

  Fly    95 RDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQA 159
            :.:||:.||:||.:|||.:|||::|..|....|.|.                             
  Rat   111 KATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCS----------------------------- 146

  Fly   160 AMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEW 224
                              ||:..:                  ||               || |:|
  Rat   147 ------------------SRLQGS------------------PG---------------EG-WKW 159

  Fly   225 GGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVK 289
            ||||:::.||...||.|.||  |:.|.|..:.:..|||.|||.||...|.|:||||||||||.||
  Rat   160 GGCSEDIEFGGMVSREFADA--RENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVK 222

  Fly   290 TCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS------FMPESPHARPANKYQLVFADDSPDF 348
            |||...|.||.:...|:|:||||.::.:.....|      ..|...:.:...:..||:.:.||:|
  Rat   223 TCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNF 287

  Fly   349 CTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEH 413
            |.||.:||:.||:.|.|||:|.|.|.||.|||.|||..|....:..|.|||.|||.|:|::|...
  Rat   288 CEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRV 352

  Fly   414 RAVNTC 419
            ..|:||
  Rat   353 YDVHTC 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 132/386 (34%)
Wnt3aNP_001100475.2 WNT1 51..359 CDD:128408 134/392 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.