DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt10b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_835737.1 Gene:wnt10b / 30308 ZFINID:ZDB-GENE-980526-524 Length:427 Species:Danio rerio


Alignment Length:457 Identity:147/457 - (32%)
Similarity:202/457 - (44%) Gaps:80/457 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLLMVIAILIF-AMPMTG---FGWAEGTNILLDPNLMCKKTRRLRGKLAEICRHD-----SALLK 57
            |:|:|.|.|:. |..:.|   .|.......:|.||.:|.:...|..|...:|...     |||  
Zfish    11 RVLIVTAALLSPAFTVLGNDILGLKVAGEPVLTPNAVCLRLAGLTKKQMRLCVRSPDVTASAL-- 73

  Fly    58 EIIINGINLGFRECEFQFRNRRWNCTVLRK-----SMRKILMRDSRETGFVNAITAAGVTYAVTK 117
                .||.:...||:.|.|::||||:.|..     ....||.|..||:.|..::.||||.::|..
Zfish    74 ----QGIQVAIHECQHQLRDQRWNCSSLENHGKLPHQSAILNRGFRESAFSLSLLAAGVVHSVAS 134

  Fly   118 ACTMGQLVECSC--------DKAHMRRNGGQPQMVTAATAEAAL----ERQQQAAMLRQQMP--L 168
            ||::|:|..|.|        ||..::..  |.|:.|...:..:|    |...:.:.|...:|  |
Zfish   135 ACSLGKLRGCGCEAKRRLDDDKIRLKLT--QLQLQTFQRSGVSLAGAGENTPELSSLHGSLPANL 197

  Fly   169 QDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNF 233
            ...||...|..:.:..||.                               :..|||||||.::.|
Zfish   198 HSSHPMSLLKPLPDEVTML-------------------------------QDTWEWGGCSHDIRF 231

  Fly   234 GLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPF 298
            |:|.||.:||::...|  |:....:.|||..||..:.|.||.:|||||.||||..||||...|.|
Zfish   232 GVRFSRDWLDSRGSPR--DIHARTRIHNNRVGRQVVTDNMRRKCKCHGTSGSCQFKTCWYVSPEF 294

  Fly   299 REVAGRLRDRYDSARKVTLRNDGNSFM-----------PESPHARPANKYQLVFADDSPDFCTPN 352
            |.|...||:::.:|..:..:|..|...           |.....|.:...:||:.:.|||||...
Zfish   295 RLVGSLLREKFLTAIFINSQNKNNGVFNSRTGGSTGSDPLRGQRRRSISRELVYFEKSPDFCDRE 359

  Fly   353 SKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVN 417
            ....:||||||.||.:|.|.|.|..|||.|||..........|.|.|.|||.|.||:|.....||
Zfish   360 PAVDSLGTQGRICNKSSPGMDGCGSLCCGRGHNILKQARSERCHCRFHWCCYVLCEECKVTEWVN 424

  Fly   418 TC 419
            .|
Zfish   425 VC 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 134/412 (33%)
wnt10bNP_835737.1 wnt 50..427 CDD:306592 135/418 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.