DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt10a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_571055.1 Gene:wnt10a / 30171 ZFINID:ZDB-GENE-990415-278 Length:442 Species:Danio rerio


Alignment Length:414 Identity:146/414 - (35%)
Similarity:196/414 - (47%) Gaps:73/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GTNILLDP----NLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTV 84
            |..|..||    |.:|.....|..|..::|..:..:... .|.||.:...||:.|||..||||:.
Zfish    83 GLKIPFDPILNANTVCLTLPGLTKKQLDVCMRNPDVTAS-AIQGIQIAIHECQHQFRGHRWNCSS 146

  Fly    85 LRKSMRKI------LMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQM 143
            | ::..||      ..|..||:.|..||.||||.:||:.||.||:|..|.||:   :|.|.:...
Zfish   147 L-ETRNKIPYESVVFSRGFRESAFAYAIAAAGVVHAVSNACAMGKLKACGCDE---KRRGDEEAF 207

  Fly   144 VTAATAEAALERQQQAAMLRQQ---MPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGR 205
                  ...|.|.|..|:.|.:   ..:.:..|::.|.                           
Zfish   208 ------RIKLNRLQLEAINRGKGMVHGVMEHFPAEALG--------------------------- 239

  Fly   206 RGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIR 270
                        |:..|||||||.||.:|.|.|:.|||:::..|  |:.:.::.|||..||..:.
Zfish   240 ------------PQDSWEWGGCSPNVEYGERFSKDFLDSRETYR--DIHSRMRLHNNRVGRQVVV 290

  Fly   271 DAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSAR--KVTLRNDGNSFMPESPHARP 333
            |.||.:|||||.||||.:||||...|.||.|...|::|::.|.  |...||.|........|.|.
Zfish   291 DHMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGSLLKERFNVATLIKAHNRNTGQVENAHHTHRRR 355

  Fly   334 ANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQT---NC 395
            ||...||:.:.|||||..:..:.:.|||||.||.||.|.|.|:.|||.|||.   :.:||   .|
Zfish   356 ANINDLVYFEKSPDFCERDLGSDSAGTQGRICNKTSQGMDNCESLCCGRGHN---ILQQTRSERC 417

  Fly   396 KCVFKWCCEVTCEKCLEHRAVNTC 419
            .|.|.|||.|.||:|.....|:.|
Zfish   418 NCKFHWCCYVVCEECRITEWVSVC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 139/391 (36%)
wnt10aNP_571055.1 wnt 104..442 CDD:278536 140/393 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.