DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt1

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_005162280.1 Gene:wnt1 / 30128 ZFINID:ZDB-GENE-980526-526 Length:375 Species:Danio rerio


Alignment Length:460 Identity:153/460 - (33%)
Similarity:215/460 - (46%) Gaps:130/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLLMVI-----AILIFAMPMTGFG--------W--------------AEGTNILLDPNLMCKKT 38
            ||:|.::     |.::....:||.|        |              ::...::|||:| ...:
Zfish     6 MRVLALLLAVKAACVLLVSSLTGTGAVNNSGRWWGIVNVASSGNLLTNSKNVQLVLDPSL-ALLS 69

  Fly    39 RRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKS--MRKILMRDSRETG 101
            ||.|    ::.|.:..:| ..|..|::...:||::|||||||||......  ..||:.|..|||.
Zfish    70 RRQR----KLIRQNPGIL-HAIAAGLHTAIKECKWQFRNRRWNCPTTHSPNVFGKIVNRGCRETA 129

  Fly   102 FVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQM 166
            ||.|||:||||:||.::|:.|.:..|:||.                                   
Zfish   130 FVFAITSAGVTHAVARSCSEGAIESCTCDY----------------------------------- 159

  Fly   167 PLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNV 231
                                           |.|.|||             |:  |.||||||||
Zfish   160 -------------------------------RRRGPGG-------------PD--WHWGGCSDNV 178

  Fly   232 NFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMP 296
            .||....|.|:|:.:|.|  ||..|...|||.|||:.:...|:.||||||:||||||:|||:::|
Zfish   179 EFGRMFGREFVDSSERGR--DLRYLTNLHNNEAGRMTVASEMQQECKCHGMSGSCTVRTCWMRLP 241

  Fly   297 PFREVAGRLRDRYDSARKVTLRNDGNS----------FMPESP-HARPANKYQLVFADDSPDFCT 350
            .||.|...|:||:|.|.:|...|.|::          ..||:| |..|::: .||:.:.||:||:
Zfish   242 SFRLVGDYLKDRFDGASRVVYANKGSNRASHRADPRHLEPENPAHKLPSSR-DLVYFEKSPNFCS 305

  Fly   351 PNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRA 415
            .|.|||..||.||.||.:|...|.|:.|||.||:..|:.:....|.|.|.|||.|:|..|...:.
Zfish   306 YNGKTGTHGTSGRTCNSSSPALDGCELLCCGRGYKTRMEQVTERCHCTFHWCCHVSCLNCTSTQT 370

  Fly   416 VNTCL 420
            |:.||
Zfish   371 VHQCL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 137/390 (35%)
wnt1XP_005162280.1 WNT1 64..375 CDD:128408 140/400 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.