DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt8a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_571021.3 Gene:wnt8a / 30122 ZFINID:ZDB-GENE-980526-332 Length:359 Species:Danio rerio


Alignment Length:366 Identity:121/366 - (33%)
Similarity:166/366 - (45%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GINLGFRECEFQFRNRRWNC--TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLV 125
            |...|..||:.||...||||  :.|:.|..|.|...:|||.||:||:||||.|.:||.|:||...
Zfish    47 GAQSGIEECKHQFAWDRWNCPESALQLSTHKGLRSATRETAFVHAISAAGVMYTLTKNCSMGDFE 111

  Fly   126 ECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIA 190
            .|.||.:.:.:.||                                                   
Zfish   112 NCGCDDSKIGKMGG--------------------------------------------------- 125

  Fly   191 PVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT 255
                           ||              |.|||||||||||.|.:::|:||.:...  |...
Zfish   126 ---------------RG--------------WVWGGCSDNVNFGDRIAKLFVDALENGH--DSRA 159

  Fly   256 LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL--- 317
            .|..|||.|||||::..::..||||||||||:::|||:::..||::...|:.::|.|||:.:   
Zfish   160 AVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLKIKHDQARKLEMDKI 224

  Fly   318 -RNDGNSFMPESPHA---RPANKYQLVFADDSPDFCTPNSKTGALGTQGREC-----NVTSSGSD 373
             ...|||.......|   ....:.:|:|.:||||:|..|...|..||:||||     |::.....
Zfish   225 RMRAGNSADNRGAIADTFSAVARTELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERR 289

  Fly   374 RCDRLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLE 412
            .|.|||  |......|.:|..::|.|.|.|||.|.||.|.:
Zfish   290 SCRRLCHECGLKVEERRIETVSSCNCKFHWCCTVKCETCTQ 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/366 (33%)
wnt8aNP_571021.3 WNT1 22..337 CDD:128408 121/366 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.