DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt8a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001099625.1 Gene:Wnt8a / 291678 RGDID:1306312 Length:359 Species:Rattus norvegicus


Alignment Length:441 Identity:131/441 - (29%)
Similarity:187/441 - (42%) Gaps:140/441 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLMVIAILIFAMPMTGFG---WAEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGI 64
            :|.|.|    .|..|.||   |:....::..|......|..:            ||       |.
  Rat    10 MLWVAA----GMCYTAFGASAWSVNNFLITGPKAYVTYTASV------------AL-------GA 51

  Fly    65 NLGFRECEFQFRNRRWNCT--VLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVEC 127
            .:|..||:|||...||||.  ..:.|........:|||.|::||.:|.|.|||||.|:||.|..|
  Rat    52 QMGMEECKFQFAWERWNCPEHAFQFSTHTRPRGATRETSFIHAIRSAAVMYAVTKNCSMGDLETC 116

  Fly   128 SCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPV 192
            .||:::..:.||.                                                    
  Rat   117 GCDESNNGKAGGH---------------------------------------------------- 129

  Fly   193 EHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLV 257
                                        .|.||||||||.||.:.||:|:|:.::.:  |...|:
  Rat   130 ----------------------------GWIWGGCSDNVEFGEKISRLFVDSLEKGK--DARALM 164

  Fly   258 KFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTL----- 317
            ..|||.|||||:|.:|:..|||||:||||:::||||::..||::...|:.:||.|.|:..     
  Rat   165 NLHNNRAGRLAVRASMKRTCKCHGISGSCSIQTCWLQLADFRQMGNYLKAKYDRALKIETDKRQL 229

  Fly   318 ----RNDG-----NSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSD 373
                |.:|     .:|:|.:       :.:|:|.:.|||:|..|:..|..||:||||...:..:.
  Rat   230 RAGNRAEGRWAPIEAFLPSA-------EAELIFLEGSPDYCNRNASLGIYGTEGRECLQNARSAS 287

  Fly   374 R-----CDRLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVN 417
            |     |.|||  |......|..|..::|.|.|:|||.|.|.:|  .|.||
  Rat   288 RWEQRSCGRLCTECGLQVEERRTEAVSSCDCNFQWCCTVKCGQC--RRVVN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/400 (30%)
Wnt8aNP_001099625.1 WNT1 25..340 CDD:128408 124/422 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.