DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt8b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_035850.2 Gene:Wnt8b / 22423 MGIID:109485 Length:368 Species:Mus musculus


Alignment Length:361 Identity:121/361 - (33%)
Similarity:159/361 - (44%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GINLGFRECEFQFRNRRWNC--TVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLV 125
            |...|..||::||...||||  ..|:.|....|...:|||.||:||::|||.|.:|:.|::|...
Mouse    63 GAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFD 127

  Fly   126 ECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIA 190
            .|.||.:...:.|||                                                  
Mouse   128 NCGCDDSRNGQLGGQ-------------------------------------------------- 142

  Fly   191 PVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT 255
                                          .|.||||||||.||...|:.|:||.:..:  |...
Mouse   143 ------------------------------GWLWGGCSDNVGFGEAISKQFVDALETGQ--DARA 175

  Fly   256 LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV-TLRN 319
            .:..|||.|||.|::..|:..|||||:|||||.:||||::|.||||...|:::|.:|.|| .|:.
Mouse   176 AMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG 240

  Fly   320 DGNSFMPESPHA---RPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDR-----CD 376
            .|||.......|   |..:..:||..:||||:|..|...|.|||:||||........|     |.
Mouse   241 AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCR 305

  Fly   377 RLC--CNRGHTRRIVEEQTNCKCVFKWCCEVTCEKC 410
            |||  |......|..|..::|.|.|.|||.|.||:|
Mouse   306 RLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQC 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/361 (34%)
Wnt8bNP_035850.2 WNT1 39..350 CDD:128408 121/361 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45757
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.