DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and egl-20

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001366963.1 Gene:egl-20 / 177821 WormBaseID:WBGene00001188 Length:393 Species:Caenorhabditis elegans


Alignment Length:428 Identity:132/428 - (30%)
Similarity:184/428 - (42%) Gaps:142/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RGKLAEICR-------HDSALLKE------IIINGINLGFRECEFQFRNRRWNCT---------- 83
            |....|:||       :..||..|      .:..|:....||||.:|:..||||:          
 Worm    57 REHFKELCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRH 121

  Fly    84 -----VLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQM 143
                 :|.|::|..    ::|..|:|||.||.:.:::||.|..|.|.||.||             
 Worm   122 GKFQDILGKTLRSA----NKEAAFLNAIMAASIVHSITKGCNTGNLTECGCD------------- 169

  Fly   144 VTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGR 208
                 ::..::|.|           .:..||  :||                             
 Worm   170 -----SKPGMQRYQ-----------AESDPS--MSR----------------------------- 187

  Fly   209 RKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLD---AKQRQRRSDLGTLVKFHNNNAGRLAIR 270
                       .|:.||||||||..|:|:::.|||   ..|..:..::..||:.|||..||.||.
 Worm   188 -----------DQFSWGGCSDNVPHGIRYAKKFLDDWETAQFDKTKNVAHLVRRHNNFVGREAIA 241

  Fly   271 DAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYD-------------------SARKVT 316
            ..:|.:|:|||:||||..|||||:|..|.:|:..|:.|||                   :.||:.
 Worm   242 QNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFAVQVTRKATKRLRRKERTERKIP 306

  Fly   317 LRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCN 381
            ||  ||               ::.:...||.:|..|...|.|||.||||...|..|:.||.|||.
 Worm   307 LR--GN---------------EMAYVHRSPSYCEKNLTAGILGTSGRECIHNSYSSESCDLLCCG 354

  Fly   382 RGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            ||:..|:...||.|:|.|.|||||.|:.|.|..||:||
 Worm   355 RGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTC 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 130/426 (31%)
egl-20NP_001366963.1 Wnt 70..393 CDD:393294 128/415 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.