DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and Wnt7a

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001093943.1 Gene:Wnt7a / 114850 RGDID:69079 Length:349 Species:Rattus norvegicus


Alignment Length:405 Identity:139/405 - (34%)
Similarity:192/405 - (47%) Gaps:98/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILLDPNLMCKKTRRLRGKLAEIC--RHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVL--RK 87
            :.|..:::|.|...|..:...||  |.|:.:   :|..|..:|..||:|||||.||||:.|  |.
  Rat    30 VALGASIICNKIPGLAPRQRAICQSRPDAII---VIGEGSQMGLDECQFQFRNGRWNCSALGERT 91

  Fly    88 SMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATAEAA 152
            ...|.|...|||..|..||.||||.:|:|.|||.|.|.:|.|||                     
  Rat    92 VFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDK--------------------- 135

  Fly   153 LERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDNIKF 217
             |:|.|                                  .||                      
  Rat   136 -EKQGQ----------------------------------YHR---------------------- 143

  Fly   218 PEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKCHGL 282
            .|| |:|||||.::.:|:..::||:||  |:.:.:..||:..|||.|||..:.:.|:|||||||:
  Rat   144 DEG-WKWGGCSADIRYGIGFAKVFVDA--REIKQNARTLMNLHNNEAGRKILEENMKLECKCHGV 205

  Fly   283 SGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV----TLRNDGNSFM----PESPHARPANKYQL 339
            |||||.||||..:|.|||:...|:|:|:.|..|    ..||...:|:    |.| :.:|.:. .|
  Rat   206 SGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLS-YRKPMDT-DL 268

  Fly   340 VFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCE 404
            |:.:.||::|..:..||::|||||.||.|:..:..||.:||.||:..........|.|.|.|||.
  Rat   269 VYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCY 333

  Fly   405 VTCEKCLEHRAVNTC 419
            |.|..|.|...:.||
  Rat   334 VKCNTCSERTEMYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 134/389 (34%)
Wnt7aNP_001093943.1 Wnt_Wnt7a 32..349 CDD:381723 139/403 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.