DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt1

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002935152.1 Gene:wnt1 / 100491444 XenbaseID:XB-GENE-485280 Length:372 Species:Xenopus tropicalis


Alignment Length:412 Identity:151/412 - (36%)
Similarity:205/412 - (49%) Gaps:103/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCT--V 84
            |:...::|||:|.....|:.|     :.|.:..:|:. |..|::...|||::|||||||||.  .
 Frog    51 AQPVPLVLDPSLQLLSRRQKR-----LIRQNPGILQS-ITRGLHSAIRECKWQFRNRRWNCPTGT 109

  Fly    85 LRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAATA 149
            ..:...||:.|..|||.||.|||:||||::|.::|:.|.:..||||.                  
 Frog   110 GNQVFGKIINRGCRETAFVFAITSAGVTHSVARSCSEGSIESCSCDY------------------ 156

  Fly   150 EAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVEHRGGRNRRPGGRRGRRKFWDN 214
                                                            |.|.|||          
 Frog   157 ------------------------------------------------RRRGPGG---------- 163

  Fly   215 IKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLECKC 279
               |:  |.|||||||:.||....|.|:|:.:|.|  ||..||..|||.||||.:...||.||||
 Frog   164 ---PD--WHWGGCSDNIEFGRFIGREFVDSSERGR--DLKYLVNLHNNQAGRLTVLTEMRQECKC 221

  Fly   280 HGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS----------FMPESP-HARP 333
            ||:||||:::|||:::||||.|...|:||:|.|.|||..|:|::          ..||:| ||.|
 Frog   222 HGMSGSCSLRTCWMRLPPFRSVGDALKDRFDGASKVTYSNNGSNRWGSRSDPPHLEPENPTHALP 286

  Fly   334 ANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCV 398
            ::: .||:.:.||:||:.:.|.|..||.||.||.||.|.|.|:.|||.||:..|..:....|.|.
 Frog   287 SSQ-DLVYFEKSPNFCSASEKNGTPGTTGRICNSTSLGLDGCELLCCGRGYRSRAEKVTERCHCT 350

  Fly   399 FKWCCEVTCEKCLEHRAVNTCL 420
            |.|||.|||..|...:.|:.||
 Frog   351 FHWCCHVTCLNCTSSQIVHECL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 143/390 (37%)
wnt1XP_002935152.1 Wnt_Wnt1 65..372 CDD:381707 144/396 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D280593at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.