DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt6 and wnt7b

DIOPT Version :9

Sequence 1:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001120105.1 Gene:wnt7b / 100145124 XenbaseID:XB-GENE-481936 Length:282 Species:Xenopus tropicalis


Alignment Length:362 Identity:123/362 - (33%)
Similarity:166/362 - (45%) Gaps:89/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LGFRECEFQFRNRRWNCTVL--RKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECS 128
            :|..||::|||..||||:.|  |....:.|...|||..|..|||||||.:|||.||:.|.|..|.
 Frog     1 MGINECQYQFRYGRWNCSALGERTVFGQELRVGSREAAFTYAITAAGVAHAVTSACSQGNLSNCG 65

  Fly   129 CDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMTDIAPVE 193
            ||:                                                             |
 Frog    66 CDR-------------------------------------------------------------E 69

  Fly   194 HRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVK 258
            .:|..|:..|                  |:|||||.::.:|:..||.|:||  |:.:.:...|:.
 Frog    70 KQGYYNQEEG------------------WKWGGCSADIKYGIDFSRKFVDA--REIKKNARRLMN 114

  Fly   259 FHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNS 323
            .|||.|||..:.:.|:|||||||:|||||.||||..:|.|||:...|:::|:.|..|.:......
 Frog   115 LHNNEAGRKVLEEKMKLECKCHGVSGSCTTKTCWNTLPKFREIGFVLKEKYNDAVHVEVVRANRL 179

  Fly   324 FMPESPHARPANKYQ------LVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNR 382
            ..|.....:....||      ||:.:.||::|..:|.||::|||||.||.||..:|.||.:||.|
 Frog   180 RQPTFLKIKKVRSYQKPMETDLVYIERSPNYCEEDSATGSVGTQGRLCNRTSPHTDGCDLMCCGR 244

  Fly   383 GHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419
            |:......:...|.|.|.|||.|.|..|.|...|.||
 Frog   245 GYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 121/360 (34%)
wnt7bNP_001120105.1 Wnt 1..282 CDD:393294 123/362 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.