DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and WNT10A

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_079492.2 Gene:WNT10A / 80326 HGNCID:13829 Length:417 Species:Homo sapiens


Alignment Length:459 Identity:152/459 - (33%)
Similarity:213/459 - (46%) Gaps:121/459 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PNNITPI-MYMDPAIHST--------LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRW 102
            ||:|..: :..:|.:::.        |.|:|..:...:|.|..:.::|..:||.|||||||::||
Human    41 PNDILDLRLPPEPVLNANTVCLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRW 105

  Fly   103 NCSTRNFSRGKNLF-GKIVDRGCRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRS-- 164
            |||:.. :|.|..: ..|..||.||::|.|||.:|.|.|:::.||:.|.:::|.||.|.:...  
Human   106 NCSSLE-TRNKIPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEA 169

  Fly   165 -----------------------PQANHQAGSVA--GVRD-WEWGGCSDNIGFGFKFSREFVDTG 203
                                   |:  |.|...|  |::| |||||||.::|||.:||::|:|:.
Human   170 FRRKLHRLQLDALQRGKGLSHGVPE--HPALPTASPGLQDSWEWGGCSPDMGFGERFSKDFLDSR 232

  Fly   204 ERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLKARFDGA 268
            |..|::..:|.||||..||..|...||::|||||.||||.:||||.....||.:|..|::||..|
Human   233 EPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRA 297

  Fly   269 TRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILLENSHPI 333
            |.::..|    .|. ..:.|..||:.|..                                    
Human   298 TLIRPHN----RNG-GQLEPGPAGAPSPA------------------------------------ 321

  Fly   334 SKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCE 398
                 |..|.|              ||:.                    ...||||.|.||.|||
Human   322 -----PGAPGP--------------RRRA--------------------SPADLVYFEKSPDFCE 347

  Fly   399 KNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKV 463
            :..|....||.||.||::|.|.||||.||||||:........|||.|.|||||.|.|:.||..:.
Human   348 REPRLDSAGTVGRLCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEW 412

  Fly   464 IYTC 467
            :..|
Human   413 VSVC 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 148/433 (34%)
WNT10ANP_079492.2 Wnt 58..417 CDD:393294 148/442 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..331 11/90 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.