DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt4b

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_571575.1 Gene:wnt4b / 791993 ZFINID:ZDB-GENE-000411-1 Length:358 Species:Danio rerio


Alignment Length:466 Identity:157/466 - (33%)
Similarity:221/466 - (47%) Gaps:142/466 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MALCSGGSSLSQ------VEGKQKSGRGRGSMWWGIAKVGEPNNITPIMYMDPAIHSTLRRKQRR 70
            :|:.:...||::      |.|.:..||.||                    :.|.        |..
Zfish    23 LAMATNWLSLARLSRSRPVSGAEPCGRLRG--------------------LSPG--------QVG 59

  Fly    71 LVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITS 135
            :.|....|:.::.|.:.:.|.|||||||||||||||.  .||.|:||:::::|.||.:|::|::|
Zfish    60 VCRARGEVMESVRKASEMVIEECQHQFRNRRWNCSTT--PRGINVFGRVMNQGTREAAFVHALSS 122

  Fly   136 AAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFV 200
            |||..::.|.||.|.:|.|.||...:..||:.            ::|.|||||:.:|..||:.||
Zfish   123 AAVAVAVTRGCSRGELERCGCDRKVRGVSPEG------------FQWSGCSDNLSYGVAFSQTFV 175

  Fly   201 DTGERGRNL---REKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIGDNLK 262
            |..||.:.:   |..||:|||||||..:...|:.||||||:||||.::|||..:..||.:|..||
Zfish   176 DEPERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMPPFRRVGAVLK 240

  Fly   263 ARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMPDILL 327
            ..|||||.|::|.                    |||...::|:                      
Zfish   241 EHFDGATEVRLTR--------------------VGSRTALLPR---------------------- 263

  Fly   328 ENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLVYLEP 392
                                                            :|:.|||.::|||||.|
Zfish   264 ------------------------------------------------DPQVKPPATRDLVYLAP 280

  Fly   393 SPSFCEKNLRQGILGTHGRQCNETS-LGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCK 456
            ||.||..:...||.||.||:||.|| |..|||.|:|||.|:|.....||:||:|.|.|||.|:|:
Zfish   281 SPDFCRLDPDNGIPGTAGRRCNGTSRLAPDGCELLCCGPGFRAGRAEVVQRCSCKFSWCCSVRCQ 345

  Fly   457 LCRTKKVIYTC 467
            .|:...:|:||
Zfish   346 QCKNTVLIHTC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 147/408 (36%)
wnt4bNP_571575.1 wnt 53..357 CDD:278536 148/416 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.