DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wg and wnt11f2

DIOPT Version :9

Sequence 1:NP_523502.1 Gene:wg / 34009 FlyBaseID:FBgn0284084 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001138276.1 Gene:wnt11f2 / 791595 ZFINID:ZDB-GENE-990603-12 Length:353 Species:Danio rerio


Alignment Length:404 Identity:129/404 - (31%)
Similarity:182/404 - (45%) Gaps:109/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYA 132
            |::|.:.|..::.::|:.|.|..|.|...|.:.|||||:   ......|...:.:|.||.:|:::
Zfish    54 QQQLCKRNLELMHSIVRAARLTKSACTSSFSDMRWNCSS---IESAPHFTPDLAKGTREAAFVFS 115

  Fly   133 ITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSR 197
            :.:|.|:|:|||||:.|.:.||:|       :...:.||..     |:.||||.||:.:|.:...
Zfish   116 LAAAVVSHAIARACASGDLPSCSC-------AAMPSEQAAP-----DFRWGGCGDNLRYGLQMGS 168

  Fly   198 EFVDTGERGRNLREK----MNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVIG 258
            .|.|...|.|....:    |.||||..||..:...:..:|||||:||||:|||||..|.:...|.
Zfish   169 AFSDAPIRNRRSGPQAFRLMQLHNNAVGRQVLMDSLEMKCKCHGVSGSCSVKTCWKGLQDISTIS 233

  Fly   259 DNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLIIPQSGLVYGEEEERMLNDHMP 323
            .:||:::..||:|                               ||:                  
Zfish   234 ADLKSKYLSATKV-------------------------------IPR------------------ 249

  Fly   324 DILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGRKHNRYHFQLNPHNPEHKPPGSKDLV 388
                                     |.|.|.                ||.|...|.:|.|..:||
Zfish   250 -------------------------QIGTRR----------------QLVPREMEVRPVGENELV 273

  Fly   389 YLEPSPSFCEKNLRQGILGTHGRQCNETSLGVDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEV 453
            ||..||.:|.:|.:||.|||..||||:|:.|.:.||||||||||.....|:||||.|.:||||.|
Zfish   274 YLVSSPDYCTQNAKQGSLGTTDRQCNKTASGSESCGLMCCGRGYNAYTEVLVERCQCKYHWCCYV 338

  Fly   454 KCKLCRTKKVIYTC 467
            .||.|:.....|.|
Zfish   339 SCKTCKRTVERYVC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wgNP_523502.1 Wnt_Wnt1 64..468 CDD:381707 129/404 (32%)
wnt11f2NP_001138276.1 wnt 50..353 CDD:278536 129/404 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.